General Information

  • ID:  hor005866
  • Uniprot ID:  Q6LEM5
  • Protein name:  Bradykinin-potentiating peptide 5a
  • Gene name:  NA
  • Organism:  Bothrops jararaca (Jararaca) (Bothrops jajaraca)
  • Family:  Bradykinin-potentiating peptide family; PHpG family; Natriuretic peptide family
  • Source:  Animal
  • Expression:  BPP-10a, BPP-10c+QQWA, BPP-13a, BPP-13+QWA and BPP-13A+QQWA seem to be found in both adult and newborn B.jararaca venoms. |Expressed in venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bothrops (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0060422 peptidyl-dipeptidase inhibitor activity; GO:0090729 toxin activity
  • GO BP:  GO:0006469 negative regulation of protein kinase activity; GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005737 cytoplasm; GO:0005829 cytosol

Sequence Information

  • Sequence:  QKWAP
  • Length:  5(117-121)
  • Propeptide:  MVLSRLAASGLLLLALLALSVDGKPVQQWAQSWPGPNIPPLKVQQWAQGGWPRPGPEIPPLTVQQWAQNWPHPQIPPLTVQQWAQGRAPGPPIPPLTVQQWAQGRAPHPPIPPAPLQKWAPLQKWAPLLQPHESPASGTTALREELSLGPEAASGVPSAGAEVGRSGSKAPAAPHRLSKSKGAAATRPMRDLRPDGKQARQNWGRMAHHDHHAAAGGGGGGGGGARRLKGLAKKGAAKGCFGLKLDRIGTMSGLG
  • Signal peptide:  MVLSRLAASGLLLLALLALSVDG
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Bradykinin-potentiating peptide 5a]: Modestly inhibits ACE (with highest affinity for the N-site) and reveals strong bradykinin-potentiating activity. Induces nitric oxide (NO) production depended on muscarinic acetylcholine receptor M1 subtype (CHRM1) a
  • Mechanism:  Negative results: does not bind to type-1 angiotensin-2 receptor (AGTR1).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6LEM5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005866_AF2.pdbhor005866_ESM.pdb

Physical Information

Mass: 70026 Formula: C30H44N8O7
Absent amino acids: CDEFGHILMNRSTVY Common amino acids: AKPQW
pI: 9.7 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: -162 Boman Index: -695
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 20
Instability Index: 1646 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1375

Literature

  • PubMed ID:  9037028
  • Title:  Cloning and sequence analysis of a Bothrops jararaca cDNA encoding a precursor of seven bradykinin-potentiating peptides and a C-type natriuretic peptide.
  • PubMed ID:  4334402
  • Title:  Angiotensin-converting enzyme inhibitors from the venom of Bothrops jararaca. Isolation, elucidatio
  • PubMed ID:  15245866
  • Title:  
  • PubMed ID:  20146532
  • Title:  
  • PubMed ID:  15912471
  • Title:  
  • PubMed ID:  18200607
  • Title:  
  • PubMed ID:  17315274
  • Title:  
  • PubMed ID:  22869554
  • Title:  
  • PubMed ID:  11994001
  • Title:  
  • PubMed ID:  17475904
  • Title:  
  • PubMed ID:  19491403
  • Title:  
  • PubMed ID:  21185808
  • Title: